Analytical Data
-
Gene name
SBF2
- Application
-
Alternative Names
SBF2; CMT4B2; KIAA1766; MTMR13; Myotubularin-related protein 13; Inactive phosphatidylinositol 3-phosphatase 13; SET-binding factor 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86WG5
-
Expression Region
1-100 aa
-
AA Sequence
MARLADYFIVVGYDHEKPGSGEGLGKIIQRFPQKDWDDTPFPQGIELFCQPGGWQLSRERKQPTFFVVVLTDIDSDRHYCSCLTFYEAEINLQGTKKEEI
-
Molecular Weight
36.74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The SBF2 (Survival of Motor Neuron Protein 2) gene is part of the SMN (Survival of Motor Neuron) complex, which plays a crucial role in the assembly of spliceosomal snRNPs (small nuclear ribonucleoproteins) and is essential for the proper functioning of RNA splicing. Research into SBF2 has gained significance due to its involvement in various neurodegenerative diseases, particularly spinal muscular atrophy (SMA) and other motor neuron disorders. SMA is characterized by the degeneration of motor neurons in the spinal cord, leading to muscle wasting and weakness. The SBF2 protein acts as a modifier in these conditions, influencing the expression and activity of the SMN complex. Studies have indicated that variations in the SBF2 gene can affect the severity of SMA, making it a potential target for therapeutic interventions. Moreover, understanding the structure and function of SBF2 through recombinant protein techniques allows researchers to explore its biological mechanisms and interactions, paving the way for innovative strategies in gene therapy and drug development. By producing and characterizing SBF2 recombinant protein, scientists aim to elucidate its role in spliceosomal assembly and motor neuron maintenance, ultimately contributing to better diagnostic and treatment options for patients suffering from neurodegenerative diseases.
