Analytical Data
-
Gene name
SBF1
- Application
-
Alternative Names
SBF1; MTMR5; Myotubularin-related protein 5; Inactive phosphatidylinositol 3-phosphatase 5; SET-binding factor 1; Sbf1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95248
-
Expression Region
1-403 aa
-
AA Sequence
MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENILQASGNFYIWRPLRIPLKCPNCRSITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEHYRQPLNVYCLLDKKLVCGHCLTIGQHHGHPIDDLQSAYLKEKDTPQKLLEQLTDTHWTDLTHLIEKLKEQKSHSEKMIQGDKEAVLQYFKELNDTLEQKKKSFLTALCDVGNLINQEYTPQIERMKEIREQQLELMALTISLQEESPLKFLEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNVLIPKMKISPKRMSCSWPGKDEKEVEFLKILNIVVVTLISVILMSILFFNQHIITFLSEITLIWFSEASLSVYQSLSNSLHKVKNILCHIFYLLKEFVWKIVSH
-
Molecular Weight
73.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SBF1, also known as "SBF translocase," is a protein that plays a crucial role in various biological processes, particularly in the context of DNA repair and replication. The study of SBF1 recombinant protein has gained prominence due to its potential implications in understanding cellular mechanisms underlying cancer development and progression. Research has shown that SBF1 is involved in maintaining genomic stability by facilitating the resolution of DNA structures that can lead to replication stress. Furthermore, aberrations in SBF1 activity have been linked to several pathologies, making it an attractive target for therapeutic interventions. The ability to produce SBF1 as a recombinant protein allows researchers to examine its structural properties, functional dynamics, and interaction with other cellular molecules in detail. Additionally, recombinant SBF1 can serve as a valuable tool for drug screening and the development of targeted therapies aimed at modulating its function in cancer. Thus, the investigation of SBF1 recombinant protein not only enhances our fundamental understanding of its biological roles but also paves the way for novel therapeutic strategies that could improve cancer treatment outcomes.
