Cat: PA1000-6684

Recombinant mouse S100A4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    S100A4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    S100A4;CAPL;MTS1;Protein S100-A4

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P07091

  • Expression Region

    1-101aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMARPLEEALDVIVSTFHKYSGKEGDKFKLN KTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLS CIAMMCNEFFEGCPDKEPRKK

  • Molecular Weight

    14 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

S100A4, a member of the S100 protein family, has garnered significant attention in recent years due to its crucial role in various cellular processes, including cell motility, differentiation, and apoptosis. This protein is characterized by the presence of two calcium-binding sites and is involved in the regulation of a number of physiological and pathological processes, particularly in the context of cancer metastasis and inflammation. Elevated levels of S100A4 have been associated with poor prognosis in various cancers, as it promotes tumor cell invasion and enhances metastasis by modulating the cytoskeleton and facilitating epithelial-to-mesenchymal transition (EMT). Furthermore, S100A4 is implicated in fibrotic diseases and tissue reparative processes, suggesting its potential as a therapeutic target. Given its significant roles, the study of recombinant S100A4 protein offers valuable insights into its functional mechanisms and interactions within cellular pathways. By producing and characterizing S100A4 in recombinant form, researchers can investigate its structural properties, binding interactions, and regulatory functions in vitro. This knowledge is essential for understanding how S100A4 contributes to disease pathology and may pave the way for the development of novel therapeutic strategies aimed at modulating its activity in cancer and other related conditions. As a result, S100A4 is not only a relevant biomarker for diagnosis and prognosis but also a promising target for innovative therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US