Analytical Data
-
Gene name
Scrg1
- Application
-
Alternative Names
Scrg1；Scrapie-responsive Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75711
-
Expression Region
21-98aa
-
AA Sequence
MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ
-
Molecular Weight
12.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Scrg1 is a highly conserved protein that has garnered significant attention in recent years due to its essential roles in cellular processes and developmental biology. Initially identified in various organisms, including plants and animals, research has revealed that Scrg1 is involved in crucial functions such as RNA processing, cell signaling, and the regulation of gene expression. Its expression patterns suggest a key role during critical developmental stages, particularly in the nervous system, where it may be involved in neural differentiation and growth. Moreover, studies have indicated that Scrg1 interacts with several key molecular pathways, potentially influencing cellular responses to environmental stresses and developmental cues. Given its involvement in fundamental biological processes, understanding Scrg1's structure and function could provide insights into various diseases, including those related to neural development and regeneration. The ongoing research on Scrg1 aims to elucidate its mechanistic roles and to explore its potential as a target for therapeutic interventions, making it a subject of great importance in both basic and translational biology.
