Analytical Data
-
Gene name
SRSF10
- Application
-
Alternative Names
SRSF10;KIAA1966;YT521;YTH domain-containing Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75494
-
Expression Region
1-183aa
-
AA Sequence
MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRPNCSWNTQYSSAYYTSRKI
-
Molecular Weight
38.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SRSF10, a member of the serine/arginine-rich splicing factor (SRSF) family, plays a critical role in pre-mRNA splicing and regulation of gene expression. This protein is known for its involvement in alternative splicing, which is crucial for generating protein diversity and regulating various cellular functions. Research on SRSF10 has gained significance due to its potential implications in cancer biology, where dysregulation of splicing factors can lead to aberrant splicing patterns and contribute to tumorigenesis. It has been observed that SRSF10 can influence the expression of genes involved in cell proliferation, apoptosis, and other key pathways associated with cancer progression. Furthermore, studies have shown that SRSF10 interacts with various co-factors and is modulated by post-translational modifications, highlighting its complex regulatory networks. Understanding the function and regulation of SRSF10 may provide insights into potential therapeutic targets for cancer treatment, as well as a broader understanding of splicing mechanisms in normal and disease contexts. Consequently, SRSF10 has emerged as a subject of interest in molecular biology and cancer research, prompting further investigations into its precise molecular mechanisms and potential clinical applications.











