Analytical Data
-
Gene name
REG1A
- Application
-
Alternative Names
REG1A；HIP；PAP；PAP1；Regenerating islet-derived Protein 3-alpha
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P05451
-
Expression Region
23-166aa
-
AA Sequence
QEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNL VSVLTQAEGA FVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSV NPGYCVSLTS STGFQKWKDVPCEDKFSFVCKFKNVDHHHHHH
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
REG1A, a member of the regenerating family of proteins, has garnered significant interest in recent years due to its potential roles in cell regeneration, differentiation, and tumorigenesis. Originally identified for its expression in pancreatic islets and its involvement in regenerative processes, REG1A has been implicated in various physiological and pathological contexts, including inflammation and cancer. Studies have shown that REG1A is overexpressed in several types of tumors, suggesting a possible role in tumor progression and metastasis. Furthermore, it has been linked to the modulation of immune responses and tissue repair mechanisms, making it a critical factor in understanding both normal cellular processes and disease states. The exploration of REG1A's structure and function has opened new avenues for therapeutic interventions, particularly in cancer treatment, where targeting its pathways could lead to enhanced strategies for combating tumor growth. As research continues to elucidate the complex biological functions of REG1A, its potential as a biomarker for disease prognosis and a target for innovative therapies is becoming increasingly evident. This ongoing investigation highlights the need for further studies to unveil the molecular mechanisms underlying REG1A's roles in health and disease, paving the way for novel clinical applications.
