Cat: PA1000-6647

Recombinant Human FCRL1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FCRL1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FCRL1;FCRH1;IFGP1;IRTA5;Fc receptor-like Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96LA6

  • Expression Region

    17-303aa

  • AA Sequence

    AELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWS SSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLE TQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSLTA EYEIPSVRESDAEQYYCVAENGYGPSPSGLVSITVRIPVSRPILMLRAPR AQAAVEDVLELHCEALRGSPPILYWFYHEDITLGSRSAPSGGGASFNLSL TEEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGARSNVDHHHHHH

  • Molecular Weight

    32 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

FCRL1 (Fc receptor-like 1) is a member of the Fc receptor family that plays a significant role in the immune response, particularly in regulating the activation and inhibition of immune cells. As a receptor expressed mainly on B cells, FCRL1 is involved in antibody production and the modulation of immune signaling pathways. Its importance has become increasingly evident in the context of autoimmune diseases, infectious diseases, and cancer, where dysregulation of immune responses can lead to pathogenesis. Research on recombinant FCRL1 proteins aims to elucidate the precise functions of this receptor in immune regulation, providing insights into its potential as a therapeutic target. By studying the structure-function relationships and interactions of FCRL1 with various ligands, scientists hope to develop strategies to manipulate immune responses in favor of immunotherapy or to inhibit harmful immune reactions in autoimmune conditions. Additionally, recombinant FCRL1 proteins serve as valuable tools for investigating the mechanisms of immune evasion by tumors and pathogens, further highlighting the relevance of this research in the development of novel immunomodulatory therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US