Cat: PA1000-6563

Recombinant Human S100A10 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    S100A10

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    S100A10;ANX2LG;CAL1L;CLP11;Protein S100-A10

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P60903

  • Expression Region

    1-97aa

  • AA Sequence

    MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPL AVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

  • Molecular Weight

    12 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

S100A10, a member of the S100 protein family, is a small calcium-binding protein that plays a vital role in various cellular processes, including cell proliferation, differentiation, and inflammation. Research indicates that S100A10 is involved in the regulation of tumor progression and metastasis, making it a potential biomarker for cancer diagnosis and prognosis. Its role in cell signaling pathways and interactions with other proteins highlights its importance in maintaining cellular homeostasis and responding to stress. The recombinant expression of S100A10 has garnered attention in scientific research due to its potential applications in immunotherapy and targeted therapies. By producing this protein in a recombinant form, researchers can better study its structure, function, and interactions at a molecular level. Moreover, understanding the precise role of S100A10 in various diseases may lead to the development of novel therapeutic strategies. The ability to produce purified S100A10 enables researchers to conduct functional assays, investigate its calcium-binding properties, and explore its interactions with potential binding partners. As such, the study of recombinant S100A10 is crucial for elucidating its biological roles and therapeutic potentials, contributing to the broader understanding of diseases associated with dysregulated S100A10 expression, particularly in cancer.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US