Analytical Data
-
Gene name
CDKAL1
- Application
-
Alternative Names
CDKAL1; Threonylcarbamoyladenosine tRNA methylthiotransferase; CDK5 regulatory subunit-associated Protein 1-like 1; tRNA-t(6A37 methylthiotransferase
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5VV42
-
Expression Region
1-97aa
-
AA Sequence
MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAAYGYKITGE
-
Molecular Weight
37.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDKL1 (Cyclin-Dependent Kinase-Like 1) is a serine/threonine kinase that plays a crucial role in various cellular processes, including cell cycle regulation and neuronal development. Recent studies have suggested that CDKL1 is involved in the pathogenesis of several neurodegenerative diseases and developmental disorders, making it a significant focus of research in molecular biology and neuroscience. The investigation of CDKL1 recombinant proteins has enabled researchers to explore its functional implications, particularly regarding its kinase activity and interaction with other cellular proteins. Understanding the biochemical properties of CDKL1 through recombinant expression systems facilitates the elucidation of its signaling pathways and biological roles. Moreover, the characterization of CDKL1 can shed light on potential therapeutic targets for conditions associated with its dysfunction. As such, the production and study of CDKL1 recombinant proteins are vital for advancing knowledge in both fundamental biological research and the development of treatment strategies for related disorders.
