Cat: PA1000-6339

Recombinant Human CBG Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CBG

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CBG;CBG;Corticosteroid-binding globulin

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P08185

  • Expression Region

    23-405aa

  • AA Sequence

    MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISM ALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTS LEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINS YVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFY VDETTVVKVPMMLQSSTISYLHDAELPCQLVQMNYVGNGTVFFILPDKGK MNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIA DLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTS KPIILRFNQPFIIMIFDHFTWSSLFLARVMNPVLDHHHHHH

  • Molecular Weight

    44 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CBG (Corticosteroid-Binding Globulin) is a crucial plasma protein that plays a significant role in the transport and regulation of steroid hormones, particularly cortisol and cortisone. The importance of CBG in the endocrine system has prompted extensive research into its structure, function, and potential applications in medical science. CBG not only serves as a carrier for glucocorticoids but also modulates their bioavailability, thereby influencing various physiological responses and stress reactions. Dysregulation of CBG levels has been associated with various health conditions, including adrenal insufficiency, inflammatory diseases, and metabolic disorders, making it a target for therapeutic interventions. Recent advancements in recombinant protein technologies have enabled the production of CBG in vitro, facilitating detailed studies of its properties and interactions with steroids. These recombinant CBG proteins can be utilized in both research and clinical settings to investigate the implications of CBG in health and disease, expanding our understanding of steroid hormone dynamics and potentially leading to novel treatments for related disorders. The ongoing exploration of CBG and its functionalities continues to be a promising avenue for advancing endocrine research and therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US