Analytical Data
-
Gene name
CDC42EP3
- Application
-
Alternative Names
CDC42EP3; BORG2; CEP3Cdc42 effector Protein 3; Binder of Rho GTPases 2; MSE55-related Cdc42-binding Protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UKI2
-
Expression Region
1-254aa
-
AA Sequence
MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKLPRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWPAEDMFDHPTPCELIKGKTKSEESLSDLTGSLLSLQLDLGPSLLDEVLNVMDKNK
-
Molecular Weight
53.68 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDC42EP3, also known as CDC42 effector protein 3, is a member of the Cdc42 effector protein family, which plays a crucial role in various cellular processes, including cytoskeletal organization, cell signaling, and regulation of cell morphology. Understanding CDC42EP3 is essential due to its involvement in critical biological functions and its implications in cancer progression and metastasis. Overexpression or dysregulation of CDC42EP3 has been linked to aggressive tumor behavior, making it a potential target for therapeutic intervention. Recent studies have focused on elucidating the molecular mechanisms underlying CDC42EP3 function, its interactions with other signaling molecules, and its effect on cell motility and adhesion. Recombinant CDC42EP3 proteins have been produced to facilitate these investigations, allowing researchers to dissect its role in cellular signaling pathways. Studying CDC42EP3 not only enhances our understanding of cell dynamic regulation but also underscores its potential as a biomarker and therapeutic target in cancer treatment. The ongoing research into CDC42EP3 aims to provide insights into its functionality and pave the way for novel strategies in combating malignancies associated with its aberrant expression.
