Analytical Data
-
Gene name
polC
- Application
-
Alternative Names
polC;polC;DNA polymerase III subunit alpha
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A0RYM0
-
Expression Region
287-832aa
-
AA Sequence
LAELKGAVQTGENKEDAAAKRMREVITGRSVLSMPNRLGGFRLRYGRACNTGYTSVGFHPAVAEILDHTIAVGTQVKIDIPGKGATVAFVDTIEAPTVRLAGGDVVKIRDVAHGIELKGSIERILHLGDMLISFGDFLENNAQLVPSGYVEEIWKMDMEAAGAAQGSPSSADEAVRISRELGVPLHPRYLYYWDQISHEELAMLLSPLDKGDAISYPAACKPVLEKLGVPHKAGPEGPVLEGDEARIFRELILDNPPGPDASAPVPELISRSSGITIRDKFSTSIGVRIGRPEKAAPRQMRPPTHCLFPVGGTGGPTNNLLKSAARPGFSADILSRRCPGCGEPSISIRCWACGERTAVERTCMQCGTDVDGEECERCGRPGLAHSRVEFPLKKMLVSAQEKTGVRAHDPLKGVKELAHQDRIAEPLEKGLIRQSRSLTVFKDGTVRFDATNSPMTHFKPSWIGTSAEKLRELGYETDVDGKKLEGPDQLVELRMQDIVIPLEGAKYLVSACGYIDAELDKLYGAPPFYKVPDLGGLIGHLVVGLA
-
Molecular Weight
59.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PolC is a DNA polymerase that plays a crucial role in the replication of DNA in various organisms, including bacteria and archaea. It is particularly important because it is responsible for synthesizing the leading and lagging strands during DNA replication, ensuring the fidelity and efficiency of genetic information transfer. The study of PolC has garnered considerable attention due to its implications in understanding the fundamental mechanisms of DNA replication, as well as its potential applications in biotechnology and medicine. For instance, insights into PolC function can lead to the development of novel antimicrobial agents targeting bacterial DNA replication processes. Researchers have been investigating the structural and functional properties of PolC, utilizing techniques such as X-ray crystallography and cryo-electron microscopy to obtain detailed images of the enzyme at work. Moreover, mutations and variations in PolC can influence the outcome of replication, which makes the enzyme a subject of interest in studies of mutagenesis and genome stability. Understanding PolC's mechanisms not only contributes to basic biological knowledge but also aids in designing interventions for diseases caused by pathogenic bacteria. Overall, the multifaceted nature of PolC research highlights its significance in both fundamental biology and practical applications, paving the way for future innovations in genetic engineering and therapeutic development.











