Analytical Data
-
Gene name
CDC42EP1
- Application
-
Alternative Names
Cdc42 effector Protein 1. Binder of Rho GTPases 5. Serum Protein MSE55
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q00587
-
Expression Region
1-384aa
-
AA Sequence
MPGPQGGRGAATMSLGKLSPVGWVSSSQGKRRLTADMISHPLGDFRHTMHVGRGGDVFGDTSFLSNHGGSSGSTHRSPRSFLAKKLQLVRRVGAPPRRMASPPAPSPAPPAISPIIKNAISLPQLNQAAYDSLVVGKLSFDSSPTSSTDGHSSYGLDSGFCTISRLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSELLGVMSLPEAPAAETPAPAANPPAPTANPTGPAANPPATTANPPAPAATPTGPAANPPAPAASSTPHGHCPNGVTAGLGPVAEVKSSPVGGGPRGPAGPALGRHWGAGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV
-
Molecular Weight
67.98 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDC42EP1, also known as CDC42 effector protein 1, is a member of the family of proteins that interact with the Rho family of GTPases, specifically CDC42. These proteins play crucial roles in regulating various cellular functions, including actin cytoskeleton organization, cell migration, and cell division. The importance of CDC42EP1 has been highlighted in recent studies that associate it with oncogenic processes and cytoskeletal dynamics, making it a candidate for cancer research. Its expression levels have been correlated with tumor progression in various malignancies, suggesting a potential role in promoting invasive behaviors of cancer cells. Additionally, CDC42EP1 is involved in the modulation of signaling pathways that influence cell proliferation and survival. Understanding the functional mechanisms of CDC42EP1 through recombinant protein studies can elucidate its roles in both normal physiology and disease states, providing insights into potential therapeutic targets. Given its significant involvement in critical cellular processes, CDC42EP1 continues to be an area of interest for researchers aiming to manipulate its pathway in the context of cancer therapy and other diseases involving aberrant cell motility and growth.
