Analytical Data
-
Gene name
CD99L2
- Application
-
Alternative Names
C99L2_HUMAN; CD99; CD99 antigen-like Protein 2; CD99L2; MIC2-like Protein 1; MIC2L1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TCZ2
-
Expression Region
1-145aa
-
AA Sequence
MVAWRSAFLVCLAFSLATLVQRGSGDFDDFNLEDAVKETSSVKPALGMYHKLDGLKQQNFILSLFWMLEVLYQGVGWATFSLKALGKNLSLTFPTSGGSRCSLVCGCITPISASVVTWCSPFCVSLLSLTKMLVSGFKAHLDNPG
-
Molecular Weight
42.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD99L2, a member of the CD99 family of proteins, has garnered significant interest in recent years due to its potential roles in immune response and cellular adhesion. It is primarily expressed in various tissues, including the heart, brain, and hematopoietic cells, suggesting a pivotal function in both physiological and pathological conditions. Research has indicated that CD99L2 may be involved in modulating immune cell interactions, influencing T-cell activation, and participating in inflammatory responses. Given its expression patterns and functional associations, the recombinant protein of CD99L2 has been studied for its potential applications in immunotherapy and cancer treatment. Understanding the molecular mechanisms underlying CD99L2's activities could offer new insights into the development of therapeutic strategies for diseases where immune dysregulation plays a critical role. Moreover, the generation and characterization of recombinant CD99L2 protein provide valuable tools for further exploration of its biological functions and interactions with other cell surface molecules, thereby enhancing our comprehension of its contributions to human health and disease.
