Cat: PA1000-6212

Recombinant Human ANP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ANP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ANP;ANPRA;Atrial natriuretic peptide receptor 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P01160

  • Expression Region

    1-153aa

  • AA Sequence

    MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEK MPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRG PWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDGIGAQSGLGCNSFR YRR

  • Molecular Weight

    43 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ANP (Atrial Natriuretic Peptide) is a critical hormone involved in cardiovascular regulation, primarily secreted by the atria of the heart in response to increased blood volume and pressure. Its primary function includes the promotion of natriuresis, diuresis, and vasodilation, making it a key player in fluid homeostasis and blood pressure regulation. Researchers have been interested in ANP due to its potential therapeutic applications in treating conditions such as hypertension, heart failure, and renal diseases. The recombinant production of ANP has gained traction in the biopharmaceutical sector, as it allows for the generation of large quantities of pure and functional peptide for both experimental and clinical applications. Understanding the structure-function relationship of ANP through recombinant technologies can provide insights into its mechanisms of action and pave the way for novel drug designs aimed at enhancing its beneficial effects or mimicking its action. Furthermore, studies involving ANP's interactions with its receptors and downstream signaling pathways are crucial for elucidating its role in cardiovascular health, thus emphasizing the importance of continued research on ANP recombinant proteins.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US