Analytical Data
-
Gene name
ANP
- Application
-
Alternative Names
ANP;ANPRA;Atrial natriuretic peptide receptor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01160
-
Expression Region
1-153aa
-
AA Sequence
MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEK MPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRG PWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDGIGAQSGLGCNSFR YRR
-
Molecular Weight
43 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ANP (Atrial Natriuretic Peptide) is a critical hormone involved in cardiovascular regulation, primarily secreted by the atria of the heart in response to increased blood volume and pressure. Its primary function includes the promotion of natriuresis, diuresis, and vasodilation, making it a key player in fluid homeostasis and blood pressure regulation. Researchers have been interested in ANP due to its potential therapeutic applications in treating conditions such as hypertension, heart failure, and renal diseases. The recombinant production of ANP has gained traction in the biopharmaceutical sector, as it allows for the generation of large quantities of pure and functional peptide for both experimental and clinical applications. Understanding the structure-function relationship of ANP through recombinant technologies can provide insights into its mechanisms of action and pave the way for novel drug designs aimed at enhancing its beneficial effects or mimicking its action. Furthermore, studies involving ANP's interactions with its receptors and downstream signaling pathways are crucial for elucidating its role in cardiovascular health, thus emphasizing the importance of continued research on ANP recombinant proteins.











