Analytical Data
-
Gene name
hdhA
- Application
-
Alternative Names
hdhA；LOG5；Polyunsaturated fatty acid 5-lipoxygenase
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0AET9
-
Expression Region
1-255aa
-
AA Sequence
MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQELN
-
Molecular Weight
34.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of the hdhA recombinant protein has gained significant attention in recent years due to its potential applications in biotechnology and medicine. HdhA, or hydroxyacyl-CoA dehydratase, is an enzyme involved in various metabolic pathways, particularly in fatty acid degradation and biosynthesis. Understanding the structure and function of hdhA is crucial for elucidating its role in cellular metabolism and developing metabolic engineering strategies for enhanced production of biofuels and bioplastics. Moreover, the recombinant expression of hdhA in model organisms enables researchers to investigate its enzymatic activity, stability, and interactions with other metabolic proteins. These studies are not only important for basic biochemical research but also for the development of therapeutic interventions in metabolic disorders. The ability to produce hdhA in a recombinant system allows for detailed kinetic and mechanistic analyses, paving the way for potential industrial applications. As a result, research on hdhA recombinant protein has positioned itself at the intersection of enzymology, metabolic engineering, and therapeutic development, highlighting its significance in advancing both scientific understanding and practical applications in various fields.
