Analytical Data
-
Gene name
CD3Z
- Application
-
Alternative Names
CD247; CD3Z; T3Z; TCRZ; T-cell surface glycoProtein CD3 zeta chain; T-cell receptor T3 zeta chain; CD antigen CD247
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P20963
-
Expression Region
62-164aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSRVKFSRSADAPAYQQGQNQLYNELNLG RREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGM KGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
-
Molecular Weight
15 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The CD3Z protein, a vital component of the T cell receptor (TCR) complex, plays a crucial role in T cell signaling and activation. Research has revealed that the CD3Z subunit is essential for T cell development and function, as it aids in transducing signals from TCR upon antigen recognition. This signaling cascade is critical for initiating adaptive immune responses, and abnormalities in CD3Z expression can lead to various immunodeficiencies and autoimmune disorders. The recombinant production of CD3Z protein has garnered attention due to its potential applications in immunotherapy, particularly in enhancing T cell responses against tumors. Advances in recombinant DNA technology have enabled the efficient expression and purification of CD3Z, facilitating detailed studies on its biophysical properties and interactions with other TCR components. Moreover, understanding the structural dynamics of CD3Z can provide insights into T cell activation mechanisms, paving the way for novel therapeutic strategies aimed at modulating immune responses. Thus, research on CD3Z recombinant protein not only deepens our comprehension of T cell biology but also holds promise for the development of innovative immunotherapeutic approaches to treat various malignancies and immune-related conditions.
