Cat: PA1000-6154

Recombinant Human tPA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    tPA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    tPA;Tissue-type plasminogen activator

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P00750

  • Expression Region

    36-562aa

  • AA Sequence

    SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKS CSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISY RGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCRNPDRD SKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGAS CLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRR LTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRS PGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQ KFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPAD LQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRT VTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGL GCGQKDVPGVYTKVTNYLDWIRDNMRPVDHHHHHH

  • Molecular Weight

    61 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Tissue Plasminogen Activator (tPA) is a crucial recombinant protein that plays a significant role in the medical management of thrombotic conditions, particularly in the treatment of acute ischemic stroke. Originally isolated from human endothelial cells, tPA functions as a serine protease that catalyzes the conversion of plasminogen to plasmin, leading to the dissolution of fibrin clots. Its efficacy in restoring blood flow and reducing neuronal damage in stroke patients has made it a standard therapeutic agent since its approval in the early 1990s. Research in the field has focused on optimizing the pharmacokinetics and safety profile of tPA, as well as exploring its potential applications in other thrombotic disorders, such as myocardial infarction and pulmonary embolism. Additionally, scientists are investigating modifications to enhance its specificity and reduce the risk of hemorrhagic complications, a significant concern associated with its use. Advances in biotechnology have facilitated the production of recombinant tPA, allowing for greater availability and consistency in treatment. Ongoing studies aim to better understand the molecular mechanisms of tPA action, leading to improved therapeutic strategies and potentially identifying novel indications for its use. Overall, the research surrounding tPA continues to evolve, reflecting its importance in the realm of cardiovascular and cerebrovascular medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US