Cat: PA2000-2874

Recombinant Human esxH Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    esxH

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    esxH;cfp7;ESAT-6-like Protein EsxH

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P9WNK2

  • Expression Region

    2-96aa

  • AA Sequence

    SQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG

  • Molecular Weight

    26.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of esxH, a gene encoding an essential protein in Mycobacterium tuberculosis, has garnered significant attention due to its role in the bacterium's pathogenicity and virulence. esxH is part of the ESX (ESAT-6 secretion system) gene family, which is crucial for the secretion of virulence factors that enable the bacterium to evade the host immune response and establish infection. Understanding the structure and function of esxH protein is fundamental for revealing the molecular mechanisms underlying tuberculosis pathogenesis. Research has shown that esxH can influence the immunogenicity of the bacterium and impact its interaction with host cells, highlighting its potential as a vaccine target or therapeutic intervention point. Moreover, advancements in genetic manipulation techniques and protein analysis have facilitated a deeper exploration of esxH, paving the way for potential breakthroughs in the development of new strategies to combat tuberculosis, a disease that remains a global health crisis. As antibiotic resistance continues to rise, the need for innovative solutions emphasizes the importance of elucidating the biological roles and pathways associated with esxH, making it a critical focus for researchers in microbiology and infectious diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US