Analytical Data
-
Gene name
esxH
- Application
-
Alternative Names
esxH；cfp7；ESAT-6-like Protein EsxH
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P9WNK2
-
Expression Region
2-96aa
-
AA Sequence
SQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG
-
Molecular Weight
26.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of esxH, a gene encoding an essential protein in Mycobacterium tuberculosis, has garnered significant attention due to its role in the bacterium's pathogenicity and virulence. esxH is part of the ESX (ESAT-6 secretion system) gene family, which is crucial for the secretion of virulence factors that enable the bacterium to evade the host immune response and establish infection. Understanding the structure and function of esxH protein is fundamental for revealing the molecular mechanisms underlying tuberculosis pathogenesis. Research has shown that esxH can influence the immunogenicity of the bacterium and impact its interaction with host cells, highlighting its potential as a vaccine target or therapeutic intervention point. Moreover, advancements in genetic manipulation techniques and protein analysis have facilitated a deeper exploration of esxH, paving the way for potential breakthroughs in the development of new strategies to combat tuberculosis, a disease that remains a global health crisis. As antibiotic resistance continues to rise, the need for innovative solutions emphasizes the importance of elucidating the biological roles and pathways associated with esxH, making it a critical focus for researchers in microbiology and infectious diseases.
