Cat: PA1000-6120

Recombinant Human GIF Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GIF

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GIF;Metallothionein-3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P14174

  • Expression Region

    2-115aa

  • AA Sequence

    PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

  • Molecular Weight

    41.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of GIF (Gastric Inhibitory Polypeptide, also known as Glucose-Dependent Insulinotropic Peptide) recombinant proteins has gained considerable attention due to their potential implications in diabetes management and metabolic disorders. GIF is a hormone produced in the intestines that plays a crucial role in stimulating insulin secretion in response to nutrient intake, particularly glucose. Understanding the molecular structure and function of GIF can provide insights into its therapeutic applications, especially in enhancing insulin sensitivity and glucose homeostasis. Researchers have been focusing on producing recombinant forms of GIF to study its biological activity, stability, and potential side effects. This involves genetic engineering techniques to ensure efficient production in host cells, such as bacteria or yeast, allowing for large-scale availability. Additionally, mapping the post-translational modifications of GIF, such as glycosylation, can further elucidate its functional characteristics. The increasing prevalence of Type 2 diabetes and obesity has made this research increasingly relevant, as developing new therapeutic strategies targeting the gastrointestinal hormones like GIF could lead to innovative treatments. Recent advances in biotechnology are paving the way for optimized production methods and enhanced formulations of GIF-based therapeutics, which could significantly improve patient outcomes and quality of life. The ongoing investigation into GIF recombinant proteins not only enhances our understanding of pancreatic function and gastrointestinal biology but also opens new avenues for clinical applications in diabetes and metabolic syndrome management.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US