Analytical Data
-
Gene name
GIF
- Application
-
Alternative Names
GIF；Metallothionein-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P14174
-
Expression Region
2-115aa
-
AA Sequence
PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
-
Molecular Weight
41.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of GIF (Gastric Inhibitory Polypeptide, also known as Glucose-Dependent Insulinotropic Peptide) recombinant proteins has gained considerable attention due to their potential implications in diabetes management and metabolic disorders. GIF is a hormone produced in the intestines that plays a crucial role in stimulating insulin secretion in response to nutrient intake, particularly glucose. Understanding the molecular structure and function of GIF can provide insights into its therapeutic applications, especially in enhancing insulin sensitivity and glucose homeostasis. Researchers have been focusing on producing recombinant forms of GIF to study its biological activity, stability, and potential side effects. This involves genetic engineering techniques to ensure efficient production in host cells, such as bacteria or yeast, allowing for large-scale availability. Additionally, mapping the post-translational modifications of GIF, such as glycosylation, can further elucidate its functional characteristics. The increasing prevalence of Type 2 diabetes and obesity has made this research increasingly relevant, as developing new therapeutic strategies targeting the gastrointestinal hormones like GIF could lead to innovative treatments. Recent advances in biotechnology are paving the way for optimized production methods and enhanced formulations of GIF-based therapeutics, which could significantly improve patient outcomes and quality of life. The ongoing investigation into GIF recombinant proteins not only enhances our understanding of pancreatic function and gastrointestinal biology but also opens new avenues for clinical applications in diabetes and metabolic syndrome management.
