Analytical Data
-
Gene name
cpg2
- Application
-
Alternative Names
cpg2;Coatomer subunit gamma-2
-
Species
Pseudomonas
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P06621
-
Expression Region
23-415aa
-
AA Sequence
ALAQKRDNVLFQAATDEQPAVIKTLEKLVNIETGTGDAEGIAAAGNFLEAELKNLGFTVTRSKSAGLVVGDNIVGKIKGRGGKNLLLMSHMDTVYLKGILAKAPFRVEGDKAYGPGIADDKGGNAVILHTLKLLKEYGVRDYGTITVLFNTDEEKGSFGSRDLIQEEAKLADYVLSFEPTSAGDEKLSLGTSGIAYVQVNITGKASHAGAAPELGVNALVEASDLVLRTMNIDDKAKNLRFNWTIAKAGNVSNIIPASATLNADVRYARNEDFDAAMKTLEERAQQKKLPEADVKVIVTRGRPAFNAGEGGKKLVDKAVAYYKEAGGTLGVEERTGGGTDAAYAALSGKPVIESLGLPGFGYHSDKAEYVDISAIPRRLYMAARLIMDLGAGK
-
Molecular Weight
68.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Cpg2, a recombinant protein derived from the bacterial pathogen M. tuberculosis, has garnered significant interest in immunological research due to its potential applications in vaccine development and therapeutic strategies. Recognized for its ability to stimulate robust immune responses, Cpg2 serves as a potent adjuvant that enhances both humoral and cellular immunity, making it a valuable candidate for improving the efficacy of existing vaccines. Its unique structural properties allow it to interact effectively with immune receptors, thus facilitating the activation of dendritic cells and T lymphocytes. The increasing global burden of infectious diseases and the demand for improved vaccine formulations have prompted extensive studies on Cpg2's immunogenic profiles and mechanisms of action. Furthermore, recent advancements in recombinant DNA technology have made it feasible to produce Cpg2 in larger quantities, paving the way for preclinical and clinical evaluations. As researchers delve deeper into its biochemical properties and potential synergistic effects with various antigens, Cpg2 is positioned at the forefront of innovative approaches to combatting vaccine-preventable diseases, reinforcing the urgent need for a comprehensive understanding of its role in the immune system. This research is critical not only for vaccine enhancement but also for addressing immune-related disorders, highlighting Cpg2's versatility as both a standalone immunomodulator and a co-adjuvant in combination therapies.











