Cat: PA2000-2853

Recombinant Human plcH Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    plcH

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    plcH;KIAA1069;PLCL3;1-phosphatidylinositol 4.5-bisphosphate phosphodiesterase eta-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P06200

  • Expression Region

    51-436aa

  • AA Sequence

    VQHVVILMQENRSFDHYFGHLNGVRGFNDPRALKRQDGKPVWYQNYKYEF SPYHWDTKVTSAQWVSSQNHEWSAFHAIWNQGRNDKWMAVQYPEAMGYFK RGDIPYYYALADAFTLCEAYHQSMMGPTNPNRLYHMSGRAAPSGDGKDVH IGNDMGDGTIGASGTVDWTTYPERLSAAGVDWRVYQEGGYRSSSLWYLYV DAYWKYRLQEQNNYDCNALAWFRNFKNAPRDSDLWQRAMLARGVDQLRKD VQENTLPQVSWIVAPYCYCEHPWWGPSFGEYYVTRVLEALTSNPEVWART VFILNYDEGDGFYDHASAPVPPWKDGVGLSTVSTAGEIEVSSGLPIGLGH RVPLIAISPWSKGGKVSAEVFDHTSVLRFLERRFGV

  • Molecular Weight

    64 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PLC-γ (phospholipase C-gamma) is an important enzyme that plays a critical role in cellular signaling pathways by hydrolyzing phosphatidylinositol 4,5-bisphosphate to generate inositol trisphosphate and diacylglycerol. This process is essential for various physiological functions, including cell proliferation, differentiation, and migration. The study of PLC-γ recombinant proteins has gained significant attention due to their implications in cancer biology and other diseases. Overexpression or dysregulation of PLC-γ is often observed in various cancers, making it a potential therapeutic target. Moreover, recombinant PLC-γ proteins can be utilized to dissect the mechanistic pathways of signal transduction and to develop new pharmacological agents. Understanding the structural and functional aspects of PLC-γ through recombinant technology enables researchers to design specific inhibitors and antibodies that can modulate its activity. This research is not only pivotal for advancing cancer treatment but also for expanding our understanding of complex cellular processes. As a result, the production and characterization of PLC-γ recombinant proteins have become a significant area of focus in biochemistry and molecular biology, contributing to the development of targeted therapies and personalized medicine approaches.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US