Analytical Data
-
Gene name
Ccl27a
- Application
-
Alternative Names
C-C motif chemokine 27. CC chemokine ILC. Cutaneous T-cell-attracting chemokine. CTACK. ESkine. IL-11 R-alpha-locus chemokine. ALP. mILC. Skinkine. Small-inducible cytokine A27
-
Species
Mouse
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Z1X0
-
Expression Region
26-120aa
-
AA Sequence
LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSNPQQQN
-
Molecular Weight
10.9 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Ccl27a, also known as C-C motif chemokine ligand 27a, is a crucial chemokine involved in immune responses and skin homeostasis. Its primary function is to attract T cells and other immune cells to sites of inflammation or injury, playing a vital role in cutaneous immune regulation. Research into Ccl27a has gained momentum due to its potential implications in autoimmune diseases, skin disorders, and therapeutic applications. Studies have demonstrated that Ccl27a is significantly upregulated in conditions such as atopic dermatitis and psoriasis, suggesting its involvement in the pathogenesis of these diseases. The recombinant production of Ccl27a protein allows for detailed investigations into its biochemical properties, receptor interactions, and functional roles in immune cell migration and skin pathology. Additionally, understanding the signaling pathways activated by Ccl27a can aid in developing novel therapeutic strategies targeting cutaneous inflammation and immune dysregulation. The generation of recombinant Ccl27a also facilitates in vitro and in vivo studies, providing insights into its role in chronic inflammatory conditions and potential use as a biomarker for disease progression or treatment efficacy. Overall, research on Ccl27a recombinant protein aims to elucidate its mechanisms and implications in both health and disease, paving the way for innovative approaches to skin-related immune therapies.
