Analytical Data
-
Gene name
RNF24
- Application
-
Alternative Names
RNF24; RING finger protein 24
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y225
-
Expression Region
1-148 aa
-
AA Sequence
MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCCYLIRLRHQAHKEFYAYKQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLHSKQDRGPPQGPLPGAENIV
-
Molecular Weight
41.91 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RNF24, a member of the RBR E3 ubiquitin ligase family, has garnered significant attention in recent years due to its potential roles in cellular processes such as protein degradation, signal transduction, and stress responses. Research indicates that RNF24 may be involved in the regulation of key signaling pathways, affecting cellular growth and differentiation. Abnormal expression or mutations in RNF24 have been linked to various diseases, including certain cancers and neurodegenerative disorders, highlighting its importance in maintaining cellular homeostasis. The study of RNF24 recombinant proteins allows for the exploration of its biochemical properties, functional mechanisms, and interactions with substrates. By producing RNF24 in vitro, researchers aim to better understand its enzymatic activity, the structural basis for its function, and its potential as a therapeutic target. Furthermore, characterizing RNF24's role in ubiquitination processes could provide insights into the broader implications of protein modification in health and disease. As scientists continue to unravel the complexities of RNF24, its recombinant protein study stands at the forefront of efforts to delineate its contributions to cellular regulation and its potential implications in clinical applications.
