Cat: PA1000-6062

Recombinant Human PRMT6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PRMT6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PRMT6;HRMT1L6;Protein arginine N-methyltransferase 6

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96LA8

  • Expression Region

    2-375aa

  • AA Sequence

    SQPKKRKLESGGGGEGGEGTEEEDGAEREAALERPRRTKRERDQLYYECY SDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCA QAGARRVYAVEASAIWQQAREVVRFNGLEDRVHVLPGPVETVELPEQVDA IVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIAPISDQML EWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEIVVQGLSGEDVLARPQ RFAQLELSRAGLEQELEAGVGGRFRCSCYGSAPMHGFAIWFQVTFPGGES EKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPR RLRVLLRYKVGDQEEKTKDFAMED

  • Molecular Weight

    43 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PRMT6 (Protein Arginine Methyltransferase 6) is a member of the protein arginine methyltransferase family, which plays a crucial role in the post-translational modification of proteins through methylation of arginine residues. This enzyme has garnered significant attention in recent years due to its involvement in various biological processes, including gene regulation, signaling pathways, and the modulation of chromatin structure. Dysregulation of PRMT6 has been linked to various human diseases, including cancer and neurological disorders, making it a potential target for therapeutic interventions. Research into PRMT6 has focused on its enzymatic mechanisms, substrate specificity, and regulatory roles within the cell. Additionally, the production of recombinant PRMT6 protein facilitates in-depth studies of its biochemical properties and interactions with other proteins, aiding in the understanding of its functional significance in cellular contexts. By elucidating the structure-function relationships of PRMT6 through recombinant protein studies, researchers aim to uncover its contributions to health and disease, ultimately paving the way for novel diagnostic and therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US