Analytical Data
-
Gene name
repD
- Application
-
Alternative Names
repD；Replication initiation Protein
-
Species
Staphylococcus aureus
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P03065
-
Expression Region
1-311aa
-
AA Sequence
MSTENHSNYLQNKDLDNFSKTGYSNSRLSGNFFTTPQPELSFDAMTIVGNLNKTNAKKLSDFMSTEPQIRLWDILQTKFKAKALQEKVYIEYDKVKADSWDRRNMRVEFNPNKLTHEEMLWLKQNIIDYMEDDGFTRLDLAFDFEDDLSDYYAMTDKAVKKTIFYGRNGKPETKYFGVRDSDRFIRIYNKKQERKDNADVEVMSEHLWRVEIELKRDMVDYWNDCFDDLHILKPDWTTPEKVKEQAMVYLLLNEEGTWGKLERHAKYKYKQLIKEISPIDLTELMKSTLKENEKQLQKQIDFWQREFRFWK
-
Molecular Weight
53.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RepD is a crucial protein implicated in the replication and maintenance of plasmids in various bacterial species, particularly in those carrying a broad-host-range plasmid. It belongs to the helicase family and plays a vital role in unwinding the DNA during the replication process. Understanding RepD is essential due to its potential applications in biotechnology and genetic engineering, where plasmid-based systems are commonly used for gene cloning, expression, and manipulation. Recent studies have focused on elucidating the biochemical and structural properties of RepD, aiming to reveal its mechanistic action and interaction with DNA. Additionally, the role of RepD in plasmid stability and its response to environmental stresses has garnered interest, as this knowledge could enhance the production of recombinant proteins and improve the efficacy of plasmid vectors. Enhanced expression systems utilizing RepD could revolutionize industrial microbiology and synthetic biology by facilitating more robust and efficient plasmid-based tools for gene delivery and manipulation. Therefore, ongoing research into RepD not only contributes to our fundamental understanding of plasmid biology but also opens avenues for innovative applications in biotechnology and medicine.
