Analytical Data
-
Gene name
CFHR1
- Application
-
Alternative Names
CFHR1；CFHL；CFHL1；CFHL1P；Complement factor H-related Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q03591
-
Expression Region
19-330aa
-
AA Sequence
EATFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWT RITCTEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGY RLQNNENNISCVERGWSTPPKCRSTDTSCVNPPTVQNAHILSRQMSKYPS GERVRYECRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGD ITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVI SREIMENYNIALRWTAKQKLYLRTGESAEFVCKRGYRLSSRSHTLRTTCW DGKLEYPTCAKRVDHHHHHH
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CFHR1 (Complement Factor H-Related Protein 1) is a crucial protein in the human immune system, playing a significant role in the regulation of the complement pathway, which is essential for innate and adaptive immunity. Researchers have been increasingly interested in CFHR1 due to its association with various diseases, particularly aHUS (atypical Hemolytic Uremic Syndrome) and age-related macular degeneration (AMD). Aberrations in the CFHR1 gene, including deletions or polymorphisms, have been linked to altered immune responses and contribute to the pathogenesis of these conditions. The study of CFHR1 recombinant proteins aims to elucidate the structural and functional aspects of CFHR1, providing insights into its interactions with other complement proteins and its role in disease mechanisms. Producing CFHR1 as a recombinant protein allows for the detailed investigation of its biochemical properties, interactions, and potential therapeutic applications. Understanding the functional implications of CFHR1 alterations may lead to innovative treatment strategies for complement-mediated diseases, emphasizing the importance of this research within the context of immunology and translational medicine. Researchers are also exploring the use of CFHR1 recombinant protein in the development of diagnostic tools and therapeutic agents, potentially paving the way for new approaches in managing complement-related disorders.
