Analytical Data
-
Gene name
CCDC76
- Application
-
Alternative Names
Ccdc76; Coiled coil domain containing 76; Coiled-coil domain-containing Protein 76; FLJ10287; FLJ11219; TRM13_HUMAN; TRMT13; tRNA [Gm4] methyltransferase; tRNA guanosine-2'-O-methyltransferase TRM13 homolog
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NUP7
-
Expression Region
1-481aa
-
AA Sequence
MATSATSPHAPGFPAEGRCGYYVEKKKRFCRMVVAAGKRFCGEHAGAMEEEDARKRILCPLDPKHTVYEDQLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLEKLIKKLRKASEGLNSTLKDHIMSHPALHDALNDPKNGDSATKHLKQQASILGNIENLKLLGPRRCFVEFGAGKGKLSHWVDIALKDAEKVHFILVEKVTTRFKVDGKHRKKNSVFERLQIDIQHLCLNKIPVLREEKLPVVGIGKHLCGMATDLALRCLVETYAASFEERNEEPLAKRIKNDKTEKEIYTLAKEGNEKNVPEKWNPVAGIVIALCCHHRCDWRHYVGKEYFRALGLGAVEFHYFQRMSSWATCGMRKTSLETSNSTTKRQDNQNDDSEEHDDGGYRITDDGADCLPGLLSVEEKKKIGHLCKLLIDQGRIQYLQQKGFSPALQYYTDPLVSLENVLLTALPNHSSSPETTA
-
Molecular Weight
80.7 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCDC77, or Coiled-Coil Domain Containing 77, is a member of the coiled-coil protein family, characterized by the presence of motifs that facilitate protein-protein interactions. Research into CCDC77 has garnered interest due to its potential role in various cellular processes, including transcription regulation, cell signaling, and cytoskeletal organization. Recent studies have indicated that CCDC77 may play a significant role in developmental biology and disease mechanisms, particularly in cancer and neurological disorders. The understanding of CCDC77's structure, function, and interaction networks is crucial for elucidating its biological significance. The recombinant production of CCDC77 proteins allows for detailed biochemical characterization and the exploration of their molecular mechanisms. This research could pave the way for identifying novel therapeutic targets and strategies, especially in conditions where CCDC77 is misregulated. Moreover, studying recombinant CCDC77 provides insights into the role of coiled-coil proteins in cellular dynamics and offers a pathway for the development of innovative biomolecular tools and potential applications in biotechnology and medicine. As such, CCDC77 represents a promising avenue for future investigations in both fundamental biology and translational research.
