Analytical Data
-
Gene name
Histone H4
- Application
-
Alternative Names
Histone H4；H4/A；H4FA；HIST1H4A；Histone H4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P62805
-
Expression Region
2-103aa
-
AA Sequence
SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLI YEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGF GG
-
Molecular Weight
12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Histone H4 is a crucial component of the nucleosome, the fundamental unit of chromatin in eukaryotic cells, playing a significant role in DNA packaging and gene regulation. Research on recombinant Histone H4 primarily focuses on understanding its structural and functional dynamics in chromatin architecture and gene expression. Histone modifications, such as acetylation and methylation, are pivotal in epigenetic regulation, influencing processes like transcription, replication, and repair. The ability to produce recombinant Histone H4 allows for detailed studies on these modifications and their impact on chromatin structure. Furthermore, utilizing recombinant methods facilitates the examination of histone variants and their specific roles in various cellular contexts, such as developmental processes and disease states, including cancer. The study of recombinant Histone H4 has broadened our understanding of how histones influence genomic stability, cellular identity, and inheritance patterns, making it an essential area of investigation in molecular biology and genetics.
