Analytical Data
-
Gene name
RNF144A
- Application
-
Alternative Names
RNF144A; KIAA0161; RNF144; UBCE7IP4; E3 ubiquitin-protein ligase RNF144A; RING finger protein 144A; UbcM4-interacting protein 4; Ubiquitin-conjugating enzyme 7-interacting protein 4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P50876
-
Expression Region
1-292 aa
-
AA Sequence
MTTARYRPTWDLALDPLVSCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQHVELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLRDVGLQTPQPVQCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDDAPIKRCPKCKVYIERDEGCAQMMCKNCKHAFCWYCPESLDDDFLLIHCDKGPCRNKLGHSRASVIWHRTQVVGIFAGFGLLLLVASPFLLLATPFVLCCKCKCSKGDDDPLPT
-
Molecular Weight
57.86 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RNF144A, a member of the RBR E3 ubiquitin ligase family, has emerged as a significant target of interest in recent research due to its potential role in various cellular processes, including protein degradation, cell cycle regulation, and response to stress. Initial studies have suggested that RNF144A may be involved in modulating inflammatory pathways and cellular signaling, making it a compelling candidate for investigation in disease contexts such as cancer and neurodegenerative disorders. The ability of RNF144A to catalyze the transfer of ubiquitin moieties to substrate proteins implicates it in the regulation of key cellular functions, impacting processes such as apoptosis and cell survival. As scientists continue to explore the biochemical properties and molecular interactions of RNF144A, the need for recombinant protein production has gained prominence. This facilitates detailed characterization of its structure, function, and potential interactions with other cellular components. The development of RNF144A recombinant proteins can also enable the functional assays necessary to dissect its roles in various biological contexts. Consequently, understanding the mechanisms underlying RNF144A's action may provide new insights into its therapeutic potentials and pave the way for novel interventions in diseases linked to dysregulated ubiquitin signaling pathways. This research is critical, as elucidating the full spectrum of RNF144A's functions could have significant implications in both basic biology and clinical applications.
