Cat: PA1000-5998

Recombinant Human H1F0 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    H1F0

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    H1F0;H1F0;H1FV;Histone H1.0

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P07305

  • Expression Region

    2-194aa

  • AA Sequence

    MHHHHHHTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAG SSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFR LAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVK KAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK

  • Molecular Weight

    22 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

H1F0, or Histone H1.0, is a variant of linker histones that plays a crucial role in the compact packaging of DNA into chromatin, thereby influencing gene expression and cellular processes such as differentiation, proliferation, and apoptosis. Research has shown that H1F0 is not merely a structural component but may also have regulatory functions, particularly in relation to gene silencing and chromatin remodeling. Its expression patterns differ across various tissues and developmental stages, suggesting its involvement in important biological processes. Recent studies have indicated that dysregulation of H1F0 is associated with several diseases, including cancer, where altered chromatin structure can lead to aberrant gene expression. Given its significance, the recombinant production of H1F0 protein has gained attention as it allows for detailed investigations into its structure-function relationships, interactions with DNA and other proteins, and its role in chromatin dynamics. Understanding H1F0 at the molecular level may provide insights into epigenetic regulation and its implications in health and disease, thus making it a significant focus within the fields of molecular biology and biomedicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US