Analytical Data
-
Gene name
H1F0
- Application
-
Alternative Names
H1F0；H1F0；H1FV；Histone H1.0
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P07305
-
Expression Region
2-194aa
-
AA Sequence
MHHHHHHTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAG SSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFR LAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVK KAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
H1F0, or Histone H1.0, is a variant of linker histones that plays a crucial role in the compact packaging of DNA into chromatin, thereby influencing gene expression and cellular processes such as differentiation, proliferation, and apoptosis. Research has shown that H1F0 is not merely a structural component but may also have regulatory functions, particularly in relation to gene silencing and chromatin remodeling. Its expression patterns differ across various tissues and developmental stages, suggesting its involvement in important biological processes. Recent studies have indicated that dysregulation of H1F0 is associated with several diseases, including cancer, where altered chromatin structure can lead to aberrant gene expression. Given its significance, the recombinant production of H1F0 protein has gained attention as it allows for detailed investigations into its structure-function relationships, interactions with DNA and other proteins, and its role in chromatin dynamics. Understanding H1F0 at the molecular level may provide insights into epigenetic regulation and its implications in health and disease, thus making it a significant focus within the fields of molecular biology and biomedicine.
