Analytical Data
-
Gene name
CLEC4B2
- Application
-
Alternative Names
CLEC4B2；
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q67DU8
-
Expression Region
1-208aa
-
AA Sequence
MMQERPAQGQVVCWSLRLWMAALISILLLSTCFIASCVVTYQLMMNKPNRRLSELHTYHSNLICFSEGTTVSEKVWSCCPKDWKPFGSYCYFTSTDSRASQNKSEEKCSLRGAHLVVIHSQEEQDFITRMLDTAAGYFIGLSDVGNSQWRWIDQTPYNDRATFWHKGEPNNDYEKCVILNYRKTMWGWNDIDCSDEENSVCQMKKIYL
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CLEC4B2, also known as DC-SIGNR (Dendritic Cell-Specific Intercellular adhesion molecule-3-Grabbing Non-integrin), is a member of the C-type lectin receptor family, primarily expressed on dendritic cells and macrophages. It plays a crucial role in the immune response by recognizing and binding to glycosylated pathogens, thereby mediating their uptake and influencing T cell activation. The study of CLEC4B2 is significant due to its involvement in various infectious diseases, including HIV, where it acts as a receptor, enhancing viral capture and presentation to T cells. Furthermore, CLEC4B2 is implicated in regulating inflammatory responses and autoimmune diseases, making it a potential therapeutic target. Researchers are increasingly focused on characterizing CLEC4B2's structure, function, and its interactions with pathogens to develop novel strategies for immunotherapy and vaccine design. Understanding its signaling pathways and the molecular mechanisms governing its activity could provide insights into enhancing immune responses or moderating excessive inflammation, contributing to improved treatments for a range of diseases. Overall, the study of CLEC4B2 is positioned at the intersection of immunology and therapeutics, reflecting its vital role in the interplay between the immune system and pathogens.
