Analytical Data
-
Gene name
CLEC4A
- Application
-
Alternative Names
CLEC4A；CLECSF6；DCIR；LLIR；C-type lectin domain family 4 member A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UMR7
-
Expression Region
1-237aa
-
AA Sequence
MTSEITYAEVRFKNEFKSSGINTASSAASKERTAPHKSNTGFPKLLCASL LIFFLLLAISFFIAFVIFFQKYSQLLEKKTTKELVHTTLECVKKNMPVEE TAWSCCPKNWKSFSSNCYFISTESASWQDSEKDCARMEAHLLVINTQEEQ DFIFQNLQEESAYFVGLSDPEGQRHWQWVDQTPYNESSTFWHPREPSDPN ERCVVLNFRKSPKRWGWNDVNCLGPQRSVCEMMKIHL
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CLEC4A, also known as Dendritic Cell-Specific Intercellular adhesion molecule-3-Grabbing Nonintegrin (DC-SIGN), is a type II membrane glycoprotein expressed primarily on dendritic cells and macrophages. It plays a pivotal role in the immune system by mediating the capture and transmission of pathogens, including viruses and bacteria, to T cells, thereby initiating adaptive immune responses. The significance of CLEC4A in pathogen recognition and immune modulation has sparked interest in its potential as a therapeutic target for a variety of diseases, including viral infections and cancer. Recent studies have focused on the development of recombinant CLEC4A proteins to better understand its structure-function relationships and elucidate the mechanisms of receptor-ligand interactions. These recombinant proteins are invaluable tools in immunological research and have the potential to enhance vaccine development and immunotherapy strategies by optimizing antigen delivery and improving immune responses. Furthermore, understanding the role of CLEC4A in modulating the immune environment could lead to novel interventions for autoimmune diseases and contribute to better vaccine design by harnessing its unique properties in antigen presentation. This highlights the importance of ongoing research into CLEC4A, as its unique characteristics and functional roles in the immune system may unlock new avenues for therapeutic innovation and disease management.
