Analytical Data
-
Gene name
S100A6
- Application
-
Alternative Names
S100A6；S100A6BP；SIP；Calcyclin-binding Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P06703
-
Expression Region
1-90aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMACPLDQAIGLLVAIFHKYSGREGDKHTLS KKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGAL ALIYNEALKG
-
Molecular Weight
12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
S100A6, a member of the S100 protein family, is a calcium-binding protein that plays a significant role in various cellular processes, including cell proliferation, differentiation, and apoptosis. Its expression is known to increase in response to certain stimuli, making it a biomarker for various pathological conditions, including cancer and cardiovascular diseases. Research has increasingly focused on S100A6 as it shows potential as a therapeutic target due to its involvement in tumor growth and metastasis. Recombinant S100A6 protein has been utilized in studies to better understand its structure-function relationships and its interactions with other proteins, which could elucidate its roles in signal transduction pathways. Moreover, understanding the mechanistic pathways involving S100A6 could pave the way for novel therapeutic strategies in treating diseases characterized by its dysregulation. The production of recombinant S100A6 enables detailed biophysical and biochemical characterization, allowing researchers to explore its functional implications in disease contexts. As such, the study of S100A6 recombinant protein not only contributes to the fundamental understanding of S100 proteins but also holds promise for innovative approaches in disease management and therapy.
