Cat: PA1000-5971

Recombinant Human S100A6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    S100A6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    S100A6;S100A6BP;SIP;Calcyclin-binding Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P06703

  • Expression Region

    1-90aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMACPLDQAIGLLVAIFHKYSGREGDKHTLS KKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGAL ALIYNEALKG

  • Molecular Weight

    12 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

S100A6, a member of the S100 protein family, is a calcium-binding protein that plays a significant role in various cellular processes, including cell proliferation, differentiation, and apoptosis. Its expression is known to increase in response to certain stimuli, making it a biomarker for various pathological conditions, including cancer and cardiovascular diseases. Research has increasingly focused on S100A6 as it shows potential as a therapeutic target due to its involvement in tumor growth and metastasis. Recombinant S100A6 protein has been utilized in studies to better understand its structure-function relationships and its interactions with other proteins, which could elucidate its roles in signal transduction pathways. Moreover, understanding the mechanistic pathways involving S100A6 could pave the way for novel therapeutic strategies in treating diseases characterized by its dysregulation. The production of recombinant S100A6 enables detailed biophysical and biochemical characterization, allowing researchers to explore its functional implications in disease contexts. As such, the study of S100A6 recombinant protein not only contributes to the fundamental understanding of S100 proteins but also holds promise for innovative approaches in disease management and therapy.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US