Analytical Data
-
Gene name
GPR37
- Application
-
Alternative Names
GPR37；Prosaposin receptor GPR37
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15354
-
Expression Region
27-265aa
-
AA Sequence
ALGVAPASRNETCLGESCAPTVIQRRGRDAWGPGNSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLFYWPRRAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYGAYAVM
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR37, also known as the G-protein-coupled receptor 37, has garnered significant attention in recent years due to its role in various physiological and pathological processes. Originally identified as a receptor with neuroprotective properties, GPR37 is linked to dopamine signaling pathways, making it relevant in the context of neurodegenerative diseases such as Parkinson's disease. The receptor's involvement in cellular signaling and its potential as a therapeutic target have spurred ongoing research into its structure, function, and interactions with other proteins. The production of recombinant GPR37 protein has become essential for elucidating its mechanisms of action, understanding its ligand binding, and exploring its role in cellular contexts. Advancements in recombinant DNA technology have enabled the generation of GPR37 proteins in various expression systems, facilitating the study of its pharmacological profiles and the development of potential drugs targeting this receptor. Furthermore, studies on GPR37 may provide insights into the pathophysiology of related disorders, paving the way for innovative therapeutic approaches. Overall, the investigation of GPR37 recombinant proteins stands as a promising avenue for both basic research and drug discovery, highlighting its significance in the realm of receptor biology and therapeutic development.
