Analytical Data
-
Gene name
RNF121
- Application
-
Alternative Names
RNF121; RING finger protein 121
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H920
-
Expression Region
193-301 aa
-
AA Sequence
ERDFAEMCADYMASTIGFYSESGMPTKHLSDSVCAVCGQQIFVDVSEEGIIENTYRLSCNHVFHEFCIRGWCIVGKKQTCPYCKEKVDLKRMFSNPWERPHVMYGQLLD
-
Molecular Weight
37.73 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RNF121 is a novel protein that belongs to the RING finger protein family, which plays a significant role in various cellular processes, including the regulation of protein stability, cell proliferation, and apoptosis. Emerging research indicates that RNF121 acts as an E3 ubiquitin ligase, facilitating the ubiquitination and subsequent degradation of target proteins involved in cellular signaling pathways. This function is crucial in maintaining cellular homeostasis and responding to stress, which links RNF121 to key physiological and pathological conditions, including cancer progression and immune response modulation. Studies have suggested that dysregulation of RNF121 may contribute to oncogenesis, making it a potential biomarker for cancer diagnosis and a target for therapeutic intervention. Additionally, RNF121's involvement in the autophagy process further emphasizes its importance in cellular metabolism and survival. Recent advancements in recombinant protein technologies have enabled the production of RNF121, allowing researchers to explore its structural and functional characteristics in greater detail. Understanding the precise mechanisms of RNF121 may provide insights into its roles in disease processes and pave the way for novel therapeutic strategies. Overall, RNF121 represents a promising subject of study in molecular biology, with implications for understanding complex disease mechanisms and developing innovative treatment approaches.
