Cat: PA1000-5964

Recombinant Human CD79A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD79A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CD79A;IGA;MB1;B-cell antigen receptor complex-associated Protein alpha chain

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P11912

  • Expression Region

    33-143aa

  • AA Sequence

    LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLG PGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRP FLDMGEGTKNRLEHHHHHH

  • Molecular Weight

    14 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD79A is a crucial component of the B-cell receptor (BCR) complex, playing a vital role in B-cell development and function. It is involved in the initiation of B-cell signaling pathways upon antigen recognition, leading to B-cell activation, proliferation, and differentiation. Research into CD79A has gained momentum due to its significance in various types of B-cell malignancies, including leukemias and lymphomas. The aberrant expression or mutation of CD79A has been associated with disease progression and patient prognosis, making it a valuable target for therapeutic interventions. Recombinant CD79A proteins are essential tools in studying the structure-function relationships of this molecule, as well as in developing targeted therapies. By using advanced techniques such as recombinant DNA technology, researchers can produce CD79A proteins in sufficient quantities for functional assays, epitope mapping, and the development of monoclonal antibodies. These insights contribute to a better understanding of B-cell biology and the etiology of B-cell-related diseases, paving the way for novel diagnostic and therapeutic strategies. The continued exploration of CD79A through recombinant protein studies is anticipated to reveal critical mechanisms underlying immune responses and malignancies, ultimately enhancing clinical outcomes for patients with B-cell disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US