Analytical Data
-
Gene name
CD79A
- Application
-
Alternative Names
CD79A;IGA;MB1;B-cell antigen receptor complex-associated Protein alpha chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11912
-
Expression Region
33-143aa
-
AA Sequence
LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLG PGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRP FLDMGEGTKNRLEHHHHHH
-
Molecular Weight
14 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD79A is a crucial component of the B-cell receptor (BCR) complex, playing a vital role in B-cell development and function. It is involved in the initiation of B-cell signaling pathways upon antigen recognition, leading to B-cell activation, proliferation, and differentiation. Research into CD79A has gained momentum due to its significance in various types of B-cell malignancies, including leukemias and lymphomas. The aberrant expression or mutation of CD79A has been associated with disease progression and patient prognosis, making it a valuable target for therapeutic interventions. Recombinant CD79A proteins are essential tools in studying the structure-function relationships of this molecule, as well as in developing targeted therapies. By using advanced techniques such as recombinant DNA technology, researchers can produce CD79A proteins in sufficient quantities for functional assays, epitope mapping, and the development of monoclonal antibodies. These insights contribute to a better understanding of B-cell biology and the etiology of B-cell-related diseases, paving the way for novel diagnostic and therapeutic strategies. The continued exploration of CD79A through recombinant protein studies is anticipated to reveal critical mechanisms underlying immune responses and malignancies, ultimately enhancing clinical outcomes for patients with B-cell disorders.











