Analytical Data
-
Gene name
CD63
- Application
-
Alternative Names
CD63；MLA1；TSPAN30；CD63 antigen
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P08962
-
Expression Region
2-238aa
-
AA Sequence
AVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
-
Molecular Weight
31.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD63, a member of the tetraspanin family, is a type III membrane protein widely expressed in various cell types, including immune and hematopoietic cells. It plays a pivotal role in the regulation of cellular processes such as adhesion, migration, and signaling. Notably, CD63 is involved in the formation and function of exosomes, which are small extracellular vesicles that facilitate intercellular communication and transport biomolecules. Increased expression of CD63 has been associated with various pathological conditions, including cancer and autoimmune diseases, making it a potential biomarker for disease progression and diagnosis. The production of recombinant CD63 protein is crucial for studying its structure, function, and interactions with other proteins. Such research can provide insights into the molecular mechanisms underlying its role in health and disease, paving the way for therapeutic applications. Moreover, recombinant CD63 can be utilized in the development of diagnostic tools and targeted therapies, highlighting its significance in biomedical research.
