Analytical Data
-
Gene name
entC3
- Application
-
Alternative Names
entC3；Enterotoxin type C-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0A0L5
-
Expression Region
28-266aa
-
AA Sequence
ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
-
Molecular Weight
43.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EntC3, a recombinant protein derived from the entC gene, plays a crucial role in the biosynthesis of enterobactin, a siderophore produced by various Gram-negative bacteria to sequester iron from the environment. Understanding the structural and functional properties of EntC3 is essential, as enterobactin is vital for bacterial survival and pathogenicity, particularly in iron-limited conditions such as those found in human hosts. Recent studies have focused on characterizing EntC3’s enzymatic activity, stability, and interaction with substrates, shedding light on its mechanism of action within the enterobactin biosynthetic pathway. Given the increasing concern over antibiotic resistance, targeting such biosynthetic pathways may offer new strategies for antimicrobial drug development. The study of EntC3 not only enhances our knowledge of bacterial iron acquisition but also provides insights into potential therapeutic interventions against bacterial infections. Additionally, advancements in recombinant protein technology have facilitated the production and purification of EntC3, allowing researchers to explore its applications in biotechnology and medicine. Thus, the investigation of EntC3 serves as a significant intersection of microbiology, biochemistry, and pharmacology, highlighting its potential impact on both fundamental science and clinical practices.
