Analytical Data
-
Gene name
CCDC12
- Application
-
Alternative Names
CCD12_HUMAN; CCDC12; Coiled coil domain containing 12; Coiled-coil domain-containing Protein 12; FLJ39430; FLJ40801; MGC23918; OTTHUMP00000164781
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WUD4
-
Expression Region
1-278aa
-
AA Sequence
MTDLNKHIKQAQTQRKQLLEESRELHREKLLVQAENRFFLEYLTNKTEEYTEQPEKVWNSYLQKSGEIERRRQESASRYAEQISVLKTALLQKENIQSSLKRKLQAMRDIAILKEKQEKEIQTLQEETKKVQAETASKTREVQAQLLQEKRLLEKQLSEPDRRLLGKRKRRELNMKAQALKLAAKRFIFEYSCGINRENQQFKKELLQLIEQAQKLTATQSHLENRKQQLQQEQWYLESLIQARQRLQGSHNQCLNRQDVPKTTPSLPQGTKSRINPK
-
Molecular Weight
59.5 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCDC12 (Coiled-Coil Domain Containing 12) is a protein implicated in various cellular processes, including cell division and cytoskeletal organization. Research into CCDC12 has gained momentum due to its potential role in human diseases, particularly in cancer and developmental disorders. As a member of the coiled-coil domain protein family, CCDC12 is thought to participate in protein-protein interactions, which are crucial for maintaining cellular integrity and signaling pathways. Previous studies have indicated that abnormal expression or mutations in CCDC12 may be linked to altered cellular behavior, making it a target for understanding the molecular mechanisms underlying tumorigenesis and other pathological conditions. Furthermore, investigating the structure and function of CCDC12 through recombinant protein techniques can shed light on its biological significance and provide insights into its potential as a biomarker or therapeutic target. The generation of recombinant CCDC12 protein allows for advanced studies, including functional assays, interaction studies, and structural analyses, thereby promoting a deeper understanding of this protein’s role in health and disease. Overall, CCDC12 represents a promising avenue for future research, with potential implications in both basic biology and clinical applications.











