Analytical Data
-
Gene name
CCDC117
- Application
-
Alternative Names
CCDC117Coiled-coil domain-containing Protein 117
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IWD4
-
Expression Region
1-170aa
-
AA Sequence
MAALGRPFSGLSIPGILDVICEEMDQTTGEPQCEVARRKLQEIEDRIIDEDEEVEADRNVNHLPSLVLSDTMKTGLKREFDEVFTKKMIESMSRPSMELVLWKPLPELLSDKPKPSSNTKNYTGESQAKHVAAGTAFPQRTELFSEPRPTGMSLYNSLETATSTEEEMEL Host
-
Molecular Weight
45.1 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCDC117, or Coiled-Coil Domain Containing 117, is a protein that has garnered attention in recent years due to its potential roles in cellular processes and signaling pathways. This protein is primarily characterized by the presence of coiled-coil domains, which facilitate protein-protein interactions, making it a significant player in various biological functions. Although studies on CCDC117 are still in their infancy, preliminary research suggests its involvement in key cellular processes such as mitosis, cellular differentiation, and response to stress. Abnormal expression or mutations in CCDC117 have been linked to certain diseases, including cancer, indicating its potential as a biomarker or therapeutic target. Recent advances in proteomics and molecular biology techniques have provided tools to better understand the structure, function, and interactions of CCDC117. This growing interest in the protein underscores the need for comprehensive studies to elucidate its mechanisms and roles in health and disease. Understanding CCDC117 could not only advance our knowledge of cellular biology but also pave the way for novel therapeutic strategies in treating diseases where this protein is implicated. Given its emerging significance, ongoing research aims to clarify its biological functions, regulatory mechanisms, and potential impacts on human health, thus representing an important frontier in molecular medicine.
