Analytical Data
-
Gene name
Klrb1a
- Application
-
Alternative Names
Klrb1a;Ly55;Ly55a;Nkrp1a;Killer cell lectin-like receptor subfamily B member 1A
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P27811
-
Expression Region
1-227aa
-
AA Sequence
MDTARVYFGLKPPRTPGAWHESPPSLPPDACRCPRSHRLALKLSCAGLILLVVTLIGMSVLVRVLIQKPSIEKCYVLIQENLNKTTDCSAKLECPQDWLSHRDKCFHVSHVSNTWEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKYNSFWIGLRYTLPDMNWKWINGSTLNSDVLKITDDTENDSCAAISGDKVTFESCNSDNRWICQKELYHETLSNYVGYGH
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Klrb1a, also known as the killer cell lectin-like receptor subfamily B member 1a, is a crucial component of the immune system, primarily expressed on a subset of natural killer (NK) cells and some T cells. Its primary function involves regulating immune responses, particularly in the recognition and elimination of infected or malignant cells. Research on Klrb1a has gained significant attention due to its potential role in modulating the activity of NK cells, which are essential for the body's defense against tumors and viral infections. Understanding the structural and functional characteristics of Klrb1a can provide insights into the mechanisms of immune evasion by tumors and pathogens, thereby informing the development of novel immunotherapies. Recombinant Klrb1a protein studies enable the exploration of its binding properties, signaling pathways, and interactions with ligands, contributing to a deeper understanding of NK cell biology. Furthermore, these studies can aid in identifying biomarkers for immunological conditions and enhancing strategies for cancer treatment and immunization. The quest to harness the therapeutic potential of Klrb1a underscores its importance in the field of immunology and cancer research, making it a valuable target for future studies aimed at improving immune responses in various diseases.











