Cat: PA1000-5901

Recombinant Mouse Klrb1a Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Klrb1a

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Klrb1a;Ly55;Ly55a;Nkrp1a;Killer cell lectin-like receptor subfamily B member 1A

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P27811

  • Expression Region

    1-227aa

  • AA Sequence

    MDTARVYFGLKPPRTPGAWHESPPSLPPDACRCPRSHRLALKLSCAGLILLVVTLIGMSVLVRVLIQKPSIEKCYVLIQENLNKTTDCSAKLECPQDWLSHRDKCFHVSHVSNTWEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKYNSFWIGLRYTLPDMNWKWINGSTLNSDVLKITDDTENDSCAAISGDKVTFESCNSDNRWICQKELYHETLSNYVGYGH

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Klrb1a, also known as the killer cell lectin-like receptor subfamily B member 1a, is a crucial component of the immune system, primarily expressed on a subset of natural killer (NK) cells and some T cells. Its primary function involves regulating immune responses, particularly in the recognition and elimination of infected or malignant cells. Research on Klrb1a has gained significant attention due to its potential role in modulating the activity of NK cells, which are essential for the body's defense against tumors and viral infections. Understanding the structural and functional characteristics of Klrb1a can provide insights into the mechanisms of immune evasion by tumors and pathogens, thereby informing the development of novel immunotherapies. Recombinant Klrb1a protein studies enable the exploration of its binding properties, signaling pathways, and interactions with ligands, contributing to a deeper understanding of NK cell biology. Furthermore, these studies can aid in identifying biomarkers for immunological conditions and enhancing strategies for cancer treatment and immunization. The quest to harness the therapeutic potential of Klrb1a underscores its importance in the field of immunology and cancer research, making it a valuable target for future studies aimed at improving immune responses in various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US