Analytical Data
-
Gene name
CATSPER3
- Application
-
Alternative Names
CATSPER3; Cation channel sperm-associated Protein 3; CatSper3; Ca(v-like Protein; One-repeat calcium channel-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86XQ3
-
Expression Region
299-398aa
-
AA Sequence
QRQQEEISRLMHIQKNADCTSFSELVENFKKTLSHTDPMVLDDFGTSLPFIDIYFSTLDYQDTTVHKLQELYYEIVHVLSLMLEDLPQEKPQSLEKVDEK
-
Molecular Weight
36.74 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CATSPER3 (Cation Channel Sperm Associated Protein 3) is a crucial gene that plays a significant role in male fertility, specifically in sperm motility and function. It encodes a protein that is part of the CATSPER channel complex, which is essential for calcium influx in sperm cells during the process of fertilization. Mutations or dysfunctions in CATSPER3 can lead to asthenozoospermia, a condition characterized by reduced sperm motility, thereby impacting male reproductive capability. Research on CATSPER3 has gained momentum due to the rising prevalence of male infertility issues and the need for effective therapeutic interventions. Understanding the structure and function of the CATSPER3 protein can provide insights into sperm physiology and the potential development of targeted treatments for infertility. Recent studies have employed techniques like recombinant protein expression to elucidate the functional properties of CATSPER3, revealing its involvement in the intricate signaling pathways that govern sperm activity. This area of research not only enhances our knowledge of male reproductive biology but also opens pathways for innovative clinical applications in reproductive health.
