Analytical Data
-
Gene name
TAPA1
- Application
-
Alternative Names
TAPA1；TAPA1；TSPAN28；CD81 antigen
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P60033
-
Expression Region
25-127aa
-
AA Sequence
GGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMF VGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVK QFY
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TAPA1, or Tumor Associated Protein 1, is a receptor-type protein that has garnered significant attention in the field of cancer research due to its potential association with tumor progression and metastasis. Studies have revealed that TAPA1 is overexpressed in various malignancies, suggesting its role as a biomarker for cancer diagnosis and prognosis. The protein facilitates cellular processes such as migration, adhesion, and invasion, which are critical for cancer cell dissemination. Understanding the mechanisms underlying TAPA1 function can offer insights into tumor biology and potentially unveil therapeutic targets. Recent advancements in recombinant protein technology have enabled the production of TAPA1 in vitro, providing a valuable tool for further functional studies. Researchers are actively investigating the interactions of TAPA1 with other cellular molecules to elucidate its involvement in signaling pathways and the tumor microenvironment. As the scientific community continues to explore the intricate relationship between TAPA1 and cancer, the development of TAPA1-based therapies could represent a promising avenue for improving clinical outcomes in cancer patients.
