Analytical Data
-
Gene name
mrcB
- Application
-
Alternative Names
mrcB；pbpF；ponB；Penicillin-binding Protein 1B
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02919
-
Expression Region
444-736aa
-
AA Sequence
SVAQDAAEKAAVEGIPALKKQRKLSDLETAIVVVDRFSGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATYLTALSQPKIYRLNTWIADAPIALRQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVPTVNLGMALGLPAVTETWIKLGVPKDQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSFPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLHLAGKTGTTNNNVDTWFAGIDGSTVTITWVGRDNNQPTKLYGA
-
Molecular Weight
38.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MrcB is a protein that plays a crucial role in the bacterial cell wall biosynthesis and maintenance, specifically in the context of peptidoglycan synthesis. As a member of the diverse family of bacterial transferases, MrcB is linked to the transpeptidation process, which cross-links peptidoglycan strands, thereby providing structural integrity to the bacterial cell wall. The understanding of MrcB's function and mechanism has garnered interest due to its potential as a target for antibiotic development, particularly in the face of rising antibiotic resistance. Researchers aim to elucidate the structure-function relationship of MrcB through recombinant protein studies, allowing for in-depth analysis of its enzymatic activity and interaction with substrates. These studies are facilitated by the expression of MrcB in heterologous systems, which enables large-scale production and purification of the protein for biochemical assays. Furthermore, structural analyses using X-ray crystallography or cryo-electron microscopy can provide insights into the active site and conformational changes upon substrate binding. Given the critical role of bacterial cell wall components in life cycle and pathogenicity, understanding MrcB's function could lead to innovations in antibiotic therapies and a better grasp of bacterial resistance mechanisms. Overall, the investigation into MrcB presents significant implications for microbiology, pharmacology, and the development of novel antimicrobial agents.
