Analytical Data
-
Gene name
lpp
- Application
-
Alternative Names
lpp;Lipoma-preferred partner
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P69776
-
Expression Region
21-78aa
-
AA Sequence
CSSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATKYRK
-
Molecular Weight
21.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on LPP (lipid phosphate phosphatase) recombinant proteins has gained significant attention due to their critical roles in various biological processes, including cell signaling, membrane dynamics, and lipid metabolism. LPPs are enzymes that catalyze the dephosphorylation of lipid phosphates, which are key intermediates in signaling pathways involved in cell proliferation, differentiation, and apoptosis. Understanding the molecular mechanisms of LPPs can provide insights into their functions in health and disease, particularly in cancer, cardiovascular disorders, and metabolic syndromes. The ability to produce recombinant LPP proteins allows for detailed biochemical characterization and functional studies, facilitating the exploration of their potential as therapeutic targets. Additionally, recombinant LPPs can be utilized in drug development and biosensor applications. With advances in recombinant DNA technology and purification methods, researchers can generate high yields of active LPP proteins, paving the way for novel biotechnological applications and therapeutic interventions.











