Analytical Data
-
Gene name
HLA-DQB1
- Application
-
Alternative Names
HLA-DQB1；HLA-DQB；HLA class II histocompatibility antigen. DQ beta 1 chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01920
-
Expression Region
33-227aa
-
AA Sequence
RDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESA
-
Molecular Weight
27.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HLA-DQB1, a critical component of the human major histocompatibility complex (MHC) Class II molecules, plays a significant role in the immune system by presenting peptides to CD4+ T cells, thus influencing both innate and adaptive immunity. Variants of the HLA-DQB1 gene are associated with various autoimmune diseases, including diabetes, multiple sclerosis, and rheumatoid arthritis, making it a key focus in immunological research. The study of HLA-DQB1 recombinant proteins provides insights into its structural and functional characteristics, facilitating the understanding of how specific HLA-DQB1 alleles contribute to disease susceptibility and immune responses. By producing recombinant HLA-DQB1 proteins, researchers can investigate their interactions with T cell receptors and other immune molecules, enabling the development of targeted immunotherapies and diagnostic tools. Additionally, these studies contribute to advancements in transplant immunology, where HLA matching is critical for graft acceptance and rejection. As such, HLA-DQB1 continues to be a vital subject in both basic and applied immunological research, with implications spanning from disease pathogenesis to therapeutic innovation.
