Analytical Data
-
Gene name
STR3
- Application
-
Alternative Names
STR3；GS2NA；SG2NA；Striatin-3
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P53101
-
Expression Region
1-465aa
-
AA Sequence
MPIKRLDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLNNEDAQNYDYSRSGNPTRSVLQHQIGKLYRVPQENVLAVSSGMTALDVILRGLVLLNGTDNHTPTIIAGDDLYGGTQRLLNFFKQQSHAVSVHVDTSDFEKFKTVFQSLDKVDCVLLESPTNPLCKVVDIPRILRFVKCISPDTTVVVDNTMMSGLNCNPLQLNPGCDVVYESATKYLNGHHDLMGGVIISKTPEIASKLYFVINSTGAGLSPMDSWLLVRGLKTLGVRLYQQQRNAMILAHWLENSCGFKPTRTNKATKTRFVGLRSNPDFKLHKSFNNGPGAVLSFETGSFEHSKRLVSSKKLSIWAVTVSFGCVNSLLSMPCKMSHASIDPELRKERDFPEDLVRLCCGIENIVDLKKDLLAAMVDADIIEVRENGKYLFNKLNKNLAVNTTIDDLHKPLSIYEEFYNQDLIRKDSELNIKSSKL
-
Molecular Weight
67.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
STR3 recombinant protein is derived from a gene that plays a crucial role in various biological processes, particularly in the cellular response to stress and metabolic regulation. Its study has gained significant attention due to its potential implications in understanding pathophysiological conditions, such as cancer, neurodegenerative diseases, and metabolic disorders. Researchers are interested in STR3 because it is involved in the regulation of reactive oxygen species and has been linked to cellular signaling pathways that influence apoptosis and cell survival. The ability to produce STR3 as a recombinant protein allows for detailed characterization of its structure and function, opening avenues for exploring its role in disease mechanisms. Moreover, the generation of STR3 can facilitate the development of potential therapeutic strategies, including the design of small molecule inhibitors or novel treatments targeting related pathways. By investigating the interactions of STR3 with other cellular components, scientists aim to gain insights into its contribution to disease progression and to identify biomarkers for early diagnosis and prognosis. Overall, the research surrounding STR3 recombinant protein is crucial for uncovering the complexities of cellular biology and for paving the way for innovative interventions in health and disease.
