Cat: PAX2000-10854

Recombinant Human REV3L Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    REV3L

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    REV3L; POLZ; REV3; DNA polymerase zeta catalytic subunit; EC 2.7.7.7; Protein reversionless 3-like; REV3-like; hREV3

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O60673

  • Expression Region

    2953-3052 aa

  • AA Sequence

    GTISQYFTTLHCPVCDDLTQHGICSKCRSQPQHVAVILNQEIRELERQQEQLVKICKNCTGCFDRHIPCVSLNCPVLFKLSRVNRELSKAPYLRQLLDQF

  • Molecular Weight

    36.74 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

REV3L, the catalytic subunit of the DNA polymerase zeta complex, plays a crucial role in DNA repair and translesion synthesis, allowing cells to bypass DNA lesions that could otherwise lead to replication forks stalling or cell death. Its involvement in various cellular processes makes it a significant focus in cancer research, as the dysregulation of REV3L has been linked to tumorigenesis and cancer progression. Investigations into REV3L’s function and regulation have unveiled its potential contributions to genomic instability, a hallmark of cancer, as well as its interactions with other proteins involved in the DNA damage response. Researchers are particularly interested in understanding how alterations in REV3L expression or activity can influence chemotherapy resistance, as well as its role in maintaining cellular homeostasis under stress conditions. This burgeoning field of study holds promise for developing novel therapeutic strategies that could enhance the efficacy of existing cancer treatments or target REV3L directly to inhibit its function in tumors that depend on its aberrant activity for survival. As such, REV3L represents a compelling target for future research aimed at elucidating its mechanisms and potential as a biomarker or therapeutic target in oncological contexts. The pursuit of a more comprehensive understanding of REV3L's biology may ultimately contribute to the ongoing challenge of overcoming cancer resistance and improving patient outcomes in clinical settings.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US