Analytical Data
-
Gene name
CDC48
- Application
-
Alternative Names
CDC48；Vesicle-fusing ATPase
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P54774
-
Expression Region
653-807aa
-
AA Sequence
DEDSRHQIFKACLRKSPIAKNVDLRALARHTQGFSGADITEICQRACKYAIRENIEKDIERERKSRENPEAMDEDTVDDEVAEIKAAHFEESMKFARRSVSDADIRKYQAFAQTLQQSRGFGSEFRFPESGDRTTTGSDPFAASAGGADEDDLYS
-
Molecular Weight
33.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDC48, also known as p97 or VCP (valosin-containing protein), is a highly conserved ATPase that plays a crucial role in various cellular processes, including protein degradation, cellular membrane fusion, and organelle biogenesis. Research on CDC48 has gained prominence due to its involvement in the ubiquitin-proteasome system, where it helps extract polyubiquitinated substrates from cellular structures for degradation. This is particularly important for maintaining cellular homeostasis and responding to stress. Mutations in the CDC48 gene have been linked to several human diseases, including neurodegenerative disorders like amyotrophic lateral sclerosis (ALS) and frontotemporal dementia (FTD), highlighting its significance in human health. In recent studies, CDC48 has also been implicated in the regulation of various signaling pathways and its interaction with other proteins indicates its versatile role in cell biology. Given its central functions, CDC48 is a potential therapeutic target in diseases associated with protein misfolding and aggregation. Understanding the biochemical properties, functional mechanisms, and regulatory pathways involving CDC48 may provide insights into novel treatment strategies for these conditions. As research progresses, the protein's capacity to influence processes like autophagy and mitochondrial function is also being explored, which could reveal new aspects of cellular regulation and repair mechanisms. Overall, the study of CDC48 and its recombinant forms is critical for elucidating its biological functions and therapeutic potential.
